| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) |
| Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) |
| Domain d1dcmb_: 1dcm B: [31103] complexed with mg |
PDB Entry: 1dcm (more details), 3 Å
SCOPe Domain Sequences for d1dcmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcmb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
v
Timeline for d1dcmb_: