Lineage for d1dcma_ (1dcm A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463960Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)
  7. 2463961Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)
  8. 2463969Domain d1dcma_: 1dcm A: [31102]
    complexed with mg

Details for d1dcma_

PDB Entry: 1dcm (more details), 3 Å

PDB Description: structure of unphosphorylated fixj-n with an atypical conformer (monomer a)
PDB Compounds: (A:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1dcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcma_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
v

SCOPe Domain Coordinates for d1dcma_:

Click to download the PDB-style file with coordinates for d1dcma_.
(The format of our PDB-style files is described here.)

Timeline for d1dcma_: