Lineage for d1d5wc_ (1d5w C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)
  7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)
  8. Domain d1d5wc_: 1d5w C: [31101]
    phosphorylated form
    complexed with so4

Details for d1d5wc_

PDB Entry: 1d5w (more details), 2.3 Å

PDB Description: phosphorylated fixj receiver domain
PDB Compounds: (C:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1d5wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5wc_ c.23.1.1 (C:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hl

SCOPe Domain Coordinates for d1d5wc_ are not available.

Timeline for d1d5wc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d5wa_, d1d5wb_