SCOP 1.59: Domain d1d5wb_: 1d5w B:

Lineage for d1d5wb_ (1d5w B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (3 families)

5. Family c.23.1.1: CheY-related [52173] (9 proteins)

6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)

8. Domain d1d5wb_: 1d5w B: [31100]

Details for d1d5wb_

PDB Entry: 1d5w, 2.3 Å

PDB Description: phosphorylated fixj receiver domain

SCOP Domain Sequences for d1d5wb_:

Sequence; same for both SEQRES and ATOM records:

>d1d5wb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtxlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hl

Timeline for d1d5wb_:

• d1d5wb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d5wb_ appears in SCOP 1.57
  
• d1d5wb_ appears in SCOP 1.61
  
• d1d5wb_ appears in the current release, SCOPe 2.08