Lineage for d1d5wa_ (1d5w A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586894Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)
  7. 1586895Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)
  8. 1586900Domain d1d5wa_: 1d5w A: [31099]
    phosphorylated form
    complexed with so4

Details for d1d5wa_

PDB Entry: 1d5w (more details), 2.3 Å

PDB Description: phosphorylated fixj receiver domain
PDB Compounds: (A:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1d5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5wa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlv

SCOPe Domain Coordinates for d1d5wa_:

Click to download the PDB-style file with coordinates for d1d5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1d5wa_: