Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) |
Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) |
Domain d1dcka_: 1dck A: [31097] complexed with 15p, mn |
PDB Entry: 1dck (more details), 2 Å
SCOPe Domain Sequences for d1dcka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcka_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase hlv
Timeline for d1dcka_: