Lineage for d1dcka_ (1dck A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) 
Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) 
Domain d1dcka_: 1dck A: [31097]
Details for d1dcka_
PDB Entry: 1dck (more details), 2 Å
PDB Description: structure of unphosphorylated fixj-n complexed with mn2+
SCOP Domain Sequences for d1dcka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcka_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlv
SCOP Domain Coordinates for d1dcka_:
Click to download the PDB-style file with coordinates for d1dcka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcka_:
- d1dcka_ appears in SCOP 1.57
- d1dcka_ appears in the current release, SCOPe 2.08
View in 3D
