SCOPe 2.07: Domain d1dbwb_: 1dbw B:

Lineage for d1dbwb_ (1dbw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)

8. Domain d1dbwb_: 1dbw B: [31096]
   complexed with 15p

Details for d1dbwb_

PDB Entry: 1dbw, 1.6 Å

PDB Description: crystal structure of fixj-n

PDB Compounds: (B:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1dbwb_:

Sequence; same for both SEQRES and ATOM records:

>d1dbwb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlval

Timeline for d1dbwb_:

• d1dbwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dbwb_ appears in SCOPe 2.06
  
• d1dbwb_ appears in the current release, SCOPe 2.08