Lineage for d1dbwb_ (1dbw B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) 
Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) 
Domain d1dbwb_: 1dbw B: [31096]
Details for d1dbwb_
PDB Entry: 1dbw (more details), 1.6 Å
PDB Description: crystal structure of fixj-n
SCOP Domain Sequences for d1dbwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbwb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlval
SCOP Domain Coordinates for d1dbwb_:
Click to download the PDB-style file with coordinates for d1dbwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dbwb_:
- d1dbwb_ appears in SCOP 1.57
- d1dbwb_ appears in the current release, SCOPe 2.08
View in 3D
