SCOPe 2.07: Domain d1rnla2: 1rnl A:5-142

Lineage for d1rnla2 (1rnl A:5-142)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Nitrate/nitrite response regulator (NarL), receiver domain [52178] (1 species)

7. Species Escherichia coli [TaxId:562] [52179] (2 PDB entries)

8. Domain d1rnla2: 1rnl A:5-142 [31091]
   Other proteins in same PDB: d1rnla1
   complexed with gol, pt

Details for d1rnla2

PDB Entry: 1rnl, 2.4 Å

PDB Description: the nitrate/nitrite response regulator protein narl from narl

PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1rnla2:

Sequence; same for both SEQRES and ATOM records:

>d1rnla2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl

Timeline for d1rnla2:

• d1rnla2 first appeared (with stable ids) in SCOP 1.55, called d1rnl_2
  
• d1rnla2 appears in SCOPe 2.06
  
• d1rnla2 appears in the current release, SCOPe 2.08