Lineage for d1rnl_2 (1rnl 5-142)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) 
Protein Nitrate/nitrite response regulator (NARL), receiver domain [52178] (1 species) Species Escherichia coli [TaxId:562] [52179] (2 PDB entries) 
Domain d1rnl_2: 1rnl 5-142 [31091]
Other proteins in same PDB: d1rnl_1
Details for d1rnl_2
PDB Entry: 1rnl (more details), 2.4 Å
PDB Description: the nitrate/nitrite response regulator protein narl from narl
SCOP Domain Sequences for d1rnl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rnl_2 c.23.1.1 (5-142) Nitrate/nitrite response regulator (NARL), receiver domain {Escherichia coli}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl
SCOP Domain Coordinates for d1rnl_2:
Click to download the PDB-style file with coordinates for d1rnl_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rnl_2:
- d1rnl_2 appears in SCOP 1.57
- d1rnl_2 appears in the current release, SCOPe 2.08, called d1rnla2
View in 3D
