Lineage for d1rnla2 (1rnl A:5-142)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101739Protein Nitrate/nitrite response regulator (NarL), receiver domain [52178] (1 species)
  7. 2101740Species Escherichia coli [TaxId:562] [52179] (2 PDB entries)
  8. 2101743Domain d1rnla2: 1rnl A:5-142 [31091]
    Other proteins in same PDB: d1rnla1
    complexed with gol, pt

Details for d1rnla2

PDB Entry: 1rnl (more details), 2.4 Å

PDB Description: the nitrate/nitrite response regulator protein narl from narl
PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1rnla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnla2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl

SCOPe Domain Coordinates for d1rnla2:

Click to download the PDB-style file with coordinates for d1rnla2.
(The format of our PDB-style files is described here.)

Timeline for d1rnla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rnla1