![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Nitrate/nitrite response regulator (NarL), receiver domain [52178] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52179] (2 PDB entries) |
![]() | Domain d1a04b2: 1a04 B:5-142 [31090] Other proteins in same PDB: d1a04a1, d1a04b1 |
PDB Entry: 1a04 (more details), 2.2 Å
SCOPe Domain Sequences for d1a04b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a04b2 c.23.1.1 (B:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa agemvlsealtpvlaasl
Timeline for d1a04b2: