SCOP 1.57: Domain d1a04b2: 1a04 B:5-142

Lineage for d1a04b2 (1a04 B:5-142)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (3 families)

5. Family c.23.1.1: CheY-related [52173] (9 proteins)

6. Protein Nitrate/nitrite response regulator (NARL), receiver domain [52178] (1 species)

7. Species Escherichia coli [TaxId:562] [52179] (2 PDB entries)

8. Domain d1a04b2: 1a04 B:5-142 [31090]
   Other proteins in same PDB: d1a04a1, d1a04b1

Details for d1a04b2

PDB Entry: 1a04, 2.2 Å

PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form

SCOP Domain Sequences for d1a04b2:

Sequence; same for both SEQRES and ATOM records:

>d1a04b2 c.23.1.1 (B:5-142) Nitrate/nitrite response regulator (NARL), receiver domain {Escherichia coli}
epatilliddhpmlrtgvkqlismapditvvgeasngeqgielaesldpdlilldlnmpg
mngletldklrekslsgrivvfsvsnheedvvtalkrgadgyllkdmepedllkalhqaa
agemvlsealtpvlaasl

Timeline for d1a04b2:

• d1a04b2 first appeared (with stable ids) in SCOP 1.55
  
• d1a04b2 appears in SCOP 1.59
  
• d1a04b2 appears in the current release, SCOPe 2.08