Lineage for d4tmya_ (4tmy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) 
Species Thermotoga maritima [TaxId:243274] [52177] (4 PDB entries) 
Domain d4tmya_: 4tmy A: [31087]
Details for d4tmya_
PDB Entry: 4tmy (more details), 2.8 Å
PDB Description: chey from thermotoga maritima (mg-iv)
SCOP Domain Sequences for d4tmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
SCOP Domain Coordinates for d4tmya_:
Click to download the PDB-style file with coordinates for d4tmya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4tmya_:
- d4tmya_ appears in SCOP 1.57
- d4tmya_ appears in the current release, SCOPe 2.08
View in 3D
