![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein CheY protein [52174] (6 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries) Uniprot Q56312 |
![]() | Domain d4tmya_: 4tmy A: [31087] complexed with mg |
PDB Entry: 4tmy (more details), 2.8 Å
SCOPe Domain Sequences for d4tmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima [TaxId: 2336]} gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
Timeline for d4tmya_: