SCOP 1.73: Domain d2tmya_: 2tmy A:

Lineage for d2tmya_ (2tmy A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries)

8. Domain d2tmya_: 2tmy A: [31086]

Details for d2tmya_

PDB Entry: 2tmy, 2.3 Å

PDB Description: chey from thermotoga maritima (apo-ii)

PDB Compounds: (A:) chey protein

SCOP Domain Sequences for d2tmya_:

Sequence; same for both SEQRES and ATOM records:

>d2tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d2tmya_:

• d2tmya_ first appeared (with stable ids) in SCOP 1.55, called d2tmy__
  
• d2tmya_ was called d2tmy__ in SCOP 1.71
  
• d2tmya_ appears in SCOP 1.75
  
• d2tmya_ appears in the current release, SCOPe 2.08