SCOP 1.71: Domain d2tmy__: 2tmy -

Lineage for d2tmy__ (2tmy -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (18 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [52177] (5 PDB entries)

8. Domain d2tmy__: 2tmy - [31086]

Details for d2tmy__

PDB Entry: 2tmy, 2.3 Å

PDB Description: chey from thermotoga maritima (apo-ii)

SCOP Domain Sequences for d2tmy__:

Sequence; same for both SEQRES and ATOM records:

>d2tmy__ c.23.1.1 (-) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d2tmy__:

• d2tmy__ first appeared (with stable ids) in SCOP 1.55
  
• d2tmy__ appears in SCOP 1.69
  
• d2tmy__ is called d2tmya_ in SCOP 1.73
  
• d2tmy__ appears in the current release, SCOPe 2.08, called d2tmya_