Lineage for d3tmyb_ (3tmy B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114728Protein CheY protein [52174] (5 species)
  7. 2114826Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries)
    Uniprot Q56312
  8. 2114830Domain d3tmyb_: 3tmy B: [31085]
    complexed with mn

Details for d3tmyb_

PDB Entry: 3tmy (more details), 2.2 Å

PDB Description: chey from thermotoga maritima (mn-iii)
PDB Compounds: (B:) chey protein

SCOPe Domain Sequences for d3tmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmyb_ c.23.1.1 (B:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

SCOPe Domain Coordinates for d3tmyb_:

Click to download the PDB-style file with coordinates for d3tmyb_.
(The format of our PDB-style files is described here.)

Timeline for d3tmyb_: