| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein CheY protein [52174] (6 species) |
| Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries) Uniprot Q56312 |
| Domain d3tmya_: 3tmy A: [31084] complexed with mn |
PDB Entry: 3tmy (more details), 2.2 Å
SCOPe Domain Sequences for d3tmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tmya_ c.23.1.1 (A:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
Timeline for d3tmya_: