Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) |
Family c.23.1.1: CheY-related [52173] (16 proteins) |
Protein CheY protein [52174] (4 species) |
Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries) |
Domain d1cey__: 1cey - [31082] |
PDB Entry: 1cey (more details)
SCOP Domain Sequences for d1cey__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cey__ c.23.1.1 (-) CheY protein {Salmonella typhimurium} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d1cey__: