![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.1: CheY-like [52172] (3 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (9 proteins) |
![]() | Protein CheY protein [52174] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries) |
![]() | Domain d1cey__: 1cey - [31082] |
PDB Entry: 1cey (more details)
SCOP Domain Sequences for d1cey__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cey__ c.23.1.1 (-) CheY protein {Salmonella typhimurium} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d1cey__: