Lineage for d2chy__ (2chy -)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (5 families) 
Family c.23.1.1: CheY-related [52173] (16 proteins) Protein CheY protein [52174] (4 species) 
Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries) 
Domain d2chy__: 2chy - [31081]
CA-atoms only, mutant protein sequence
Details for d2chy__
PDB Entry: 2chy (more details), 2.7 Å
PDB Description: three-dimensional structure of chey, the response regulator of bacterial chemotaxis
SCOP Domain Sequences for d2chy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chy__ c.23.1.1 (-) CheY protein {Salmonella typhimurium}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiicdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d2chy__:
Click to download the PDB-style file with coordinates for d2chy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2chy__:
- d2chy__ first appeared (with stable ids) in SCOP 1.55
- d2chy__ appears in SCOP 1.65
- d2chy__ appears in SCOP 1.69
- d2chy__ appears in the current release, SCOPe 2.08, called d2chya_
View in 3D