SCOP 1.73: Domain d2chea_: 2che A:

Lineage for d2chea_ (2che A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (11 PDB entries)

8. Domain d2chea_: 2che A: [31080]
   complexed with mg

Details for d2chea_

PDB Entry: 2che, 1.8 Å

PDB Description: structure of the mg2+-bound form of chey and mechanism of phosphoryl transfer in bacterial chemotaxis

PDB Compounds: (A:) chey

SCOP Domain Sequences for d2chea_:

Sequence; same for both SEQRES and ATOM records:

>d2chea_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 602]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2chea_:

• d2chea_ first appeared (with stable ids) in SCOP 1.55, called d2che__
  
• d2chea_ was called d2che__ in SCOP 1.71
  
• d2chea_ appears in SCOP 1.75
  
• d2chea_ appears in the current release, SCOPe 2.08