| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (18 proteins) |
| Protein CheY protein [52174] (4 species) |
| Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries) |
| Domain d2che__: 2che - [31080] complexed with mg |
PDB Entry: 2che (more details), 1.8 Å
SCOP Domain Sequences for d2che__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2che__ c.23.1.1 (-) CheY protein {Salmonella typhimurium}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
Timeline for d2che__: