Lineage for d2che__ (2che -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) 
Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries) 
Domain d2che__: 2che - [31080]
Details for d2che__
PDB Entry: 2che (more details), 1.8 Å
PDB Description: structure of the mg2+-bound form of chey and mechanism of phosphoryl transfer in bacterial chemotaxis
SCOP Domain Sequences for d2che__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2che__ c.23.1.1 (-) CheY protein {Salmonella typhimurium}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d2che__:
Click to download the PDB-style file with coordinates for d2che__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2che__:
- d2che__ first appeared (with stable ids) in SCOP 1.55
- d2che__ appears in SCOP 1.59
- d2che__ appears in the current release, SCOPe 2.08, called d2chea_
View in 3D