SCOP 1.71: Domain d2chf__: 2chf -

Lineage for d2chf__ (2chf -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (18 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (4 PDB entries)

8. Domain d2chf__: 2chf - [31079]

Details for d2chf__

PDB Entry: 2chf, 1.8 Å

PDB Description: structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis

SCOP Domain Sequences for d2chf__:

Sequence; same for both SEQRES and ATOM records:

>d2chf__ c.23.1.1 (-) CheY protein {Salmonella typhimurium}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2chf__:

• d2chf__ first appeared (with stable ids) in SCOP 1.55
  
• d2chf__ appears in SCOP 1.69
  
• d2chf__ is called d2chfa_ in SCOP 1.73
  
• d2chf__ appears in the current release, SCOPe 2.08, called d2chfa_