SCOPe 2.08: Domain d2chfa_: 2chf A:

Lineage for d2chfa_ (2chf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (6 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2chfa_: 2chf A: [31079]

Details for d2chfa_

PDB Entry: 2chf, 1.8 Å

PDB Description: structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis

PDB Compounds: (A:) chey

SCOPe Domain Sequences for d2chfa_:

Sequence; same for both SEQRES and ATOM records:

>d2chfa_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2chfa_:

• d2chfa_ first appeared (with stable ids) in SCOP 1.55, called d2chf__
  
• d2chfa_ appears in SCOPe 2.07