Lineage for d2chfa_ (2chf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855436Protein CheY protein [52174] (6 species)
  7. 2855514Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)
  8. 2855522Domain d2chfa_: 2chf A: [31079]

Details for d2chfa_

PDB Entry: 2chf (more details), 1.8 Å

PDB Description: structure of the mg2+-bound form of chey and the mechanism of phosphoryl transfer in bacterial chemotaxis
PDB Compounds: (A:) chey

SCOPe Domain Sequences for d2chfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chfa_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d2chfa_:

Click to download the PDB-style file with coordinates for d2chfa_.
(The format of our PDB-style files is described here.)

Timeline for d2chfa_: