Lineage for d1djma_ (1djm A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481079Protein CheY protein [52174] (4 species)
  7. 481080Species Escherichia coli [TaxId:562] [52175] (30 PDB entries)
  8. 481128Domain d1djma_: 1djm A: [31078]
    bef3-activated

Details for d1djma_

PDB Entry: 1djm (more details)

PDB Description: solution structure of bef3-activated chey from escherichia coli

SCOP Domain Sequences for d1djma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djma_ c.23.1.1 (A:) CheY protein {Escherichia coli}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

SCOP Domain Coordinates for d1djma_:

Click to download the PDB-style file with coordinates for d1djma_.
(The format of our PDB-style files is described here.)

Timeline for d1djma_: