![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein CheY protein [52174] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [52175] (42 PDB entries) Uniprot P06143 |
![]() | Domain d1ffwc_: 1ffw C: [31076] Other proteins in same PDB: d1ffwb_, d1ffwd_ complexed with mn, pon |
PDB Entry: 1ffw (more details), 2.7 Å
SCOPe Domain Sequences for d1ffwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffwc_ c.23.1.1 (C:) CheY protein {Escherichia coli [TaxId: 562]} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d1ffwc_: