![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.1: CheY-like [52172] (3 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (9 proteins) |
![]() | Protein CheY protein [52174] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) |
![]() | Domain d1a0oc_: 1a0o C: [31072] Other proteins in same PDB: d1a0ob_, d1a0od_, d1a0of_, d1a0oh_ |
PDB Entry: 1a0o (more details), 2.95 Å
SCOP Domain Sequences for d1a0oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0oc_ c.23.1.1 (C:) CheY protein {Escherichia coli} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d1a0oc_: