Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) |
Family c.23.1.1: CheY-related [52173] (17 proteins) |
Protein CheY protein [52174] (4 species) |
Species Escherichia coli [TaxId:562] [52175] (30 PDB entries) |
Domain d1bdja_: 1bdj A: [31070] Other proteins in same PDB: d1bdjb_ |
PDB Entry: 1bdj (more details), 2.68 Å
SCOP Domain Sequences for d1bdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdja_ c.23.1.1 (A:) CheY protein {Escherichia coli} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d1bdja_: