SCOPe 2.07: Domain d6chyb_: 6chy B:

Lineage for d6chyb_ (6chy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d6chyb_: 6chy B: [31063]
   complexed with so4

Details for d6chyb_

PDB Entry: 6chy, 2.33 Å

PDB Description: structure of chemotaxis protein chey

PDB Compounds: (B:) chey

SCOPe Domain Sequences for d6chyb_:

Sequence; same for both SEQRES and ATOM records:

>d6chyb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

Timeline for d6chyb_:

• d6chyb_ first appeared (with stable ids) in SCOP 1.55
  
• d6chyb_ appears in SCOPe 2.06
  
• d6chyb_ appears in the current release, SCOPe 2.08