Lineage for d6chyb_ (6chy B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21776Protein CheY protein [52174] (3 species)
  7. 21777Species Escherichia coli [TaxId:562] [52175] (24 PDB entries)
  8. 21803Domain d6chyb_: 6chy B: [31063]

Details for d6chyb_

PDB Entry: 6chy (more details), 2.33 Å

PDB Description: structure of chemotaxis protein chey

SCOP Domain Sequences for d6chyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chyb_ c.23.1.1 (B:) CheY protein {Escherichia coli}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOP Domain Coordinates for d6chyb_:

Click to download the PDB-style file with coordinates for d6chyb_.
(The format of our PDB-style files is described here.)

Timeline for d6chyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6chya_