Lineage for d6chyb_ (6chy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855436Protein CheY protein [52174] (6 species)
  7. 2855439Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2855473Domain d6chyb_: 6chy B: [31063]
    complexed with so4

Details for d6chyb_

PDB Entry: 6chy (more details), 2.33 Å

PDB Description: structure of chemotaxis protein chey
PDB Compounds: (B:) chey

SCOPe Domain Sequences for d6chyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chyb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d6chyb_:

Click to download the PDB-style file with coordinates for d6chyb_.
(The format of our PDB-style files is described here.)

Timeline for d6chyb_: