Lineage for d6chya_ (6chy A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114728Protein CheY protein [52174] (5 species)
  7. 2114729Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2114777Domain d6chya_: 6chy A: [31062]
    complexed with so4

Details for d6chya_

PDB Entry: 6chy (more details), 2.33 Å

PDB Description: structure of chemotaxis protein chey
PDB Compounds: (A:) chey

SCOPe Domain Sequences for d6chya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chya_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d6chya_:

Click to download the PDB-style file with coordinates for d6chya_.
(The format of our PDB-style files is described here.)

Timeline for d6chya_: