Lineage for d6chya_ (6chy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d6chya_: 6chy A: [31062]
Details for d6chya_
PDB Entry: 6chy (more details), 2.33 Å
PDB Description: structure of chemotaxis protein chey
SCOP Domain Sequences for d6chya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6chya_ c.23.1.1 (A:) CheY protein {Escherichia coli}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d6chya_:
Click to download the PDB-style file with coordinates for d6chya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6chya_:
- d6chya_ appears in SCOP 1.57
- d6chya_ appears in the current release, SCOPe 2.08
View in 3D
