![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.1: CheY-like [52172] (3 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (9 proteins) |
![]() | Protein CheY protein [52174] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) |
![]() | Domain d1hey__: 1hey - [31061] |
PDB Entry: 1hey (more details), 2.24 Å
SCOP Domain Sequences for d1hey__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hey__ c.23.1.1 (-) CheY protein {Escherichia coli} dkelkflvvgnggtgkstvrnllkelgfnnvedaedgvdalnklqaggygfvisdwnmpn mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk ifeklgm
Timeline for d1hey__: