Lineage for d1hey__ (1hey -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1hey__: 1hey - [31061]
Details for d1hey__
PDB Entry: 1hey (more details), 2.24 Å
PDB Description: investigating the structural determinants of the p21-like triphosphate and mg2+ binding site
SCOP Domain Sequences for d1hey__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hey__ c.23.1.1 (-) CheY protein {Escherichia coli}
dkelkflvvgnggtgkstvrnllkelgfnnvedaedgvdalnklqaggygfvisdwnmpn
mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
ifeklgm
SCOP Domain Coordinates for d1hey__:
Click to download the PDB-style file with coordinates for d1hey__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hey__:
- d1hey__ appears in SCOP 1.57
- d1hey__ appears in the current release, SCOPe 2.08, called d1heya_
View in 3D