Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) |
Family c.23.1.1: CheY-related [52173] (18 proteins) |
Protein CheY protein [52174] (4 species) |
Species Escherichia coli [TaxId:562] [52175] (31 PDB entries) |
Domain d1f4vc_: 1f4v C: [31060] bound to the N-terminus of FliM complexed with bef, gol, mg |
PDB Entry: 1f4v (more details), 2.22 Å
SCOP Domain Sequences for d1f4vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4vc_ c.23.1.1 (C:) CheY protein {Escherichia coli} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifekl
Timeline for d1f4vc_: