SCOP 1.65: Domain d1ab6b_: 1ab6 B:

Lineage for d1ab6b_ (1ab6 B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (13 proteins)

6. Protein CheY protein [52174] (3 species)

7. Species Escherichia coli [TaxId:562] [52175] (30 PDB entries)

8. Domain d1ab6b_: 1ab6 B: [31055]
   mutant

Details for d1ab6b_

PDB Entry: 1ab6, 2.2 Å

PDB Description: structure of chey mutant f14n, v86t

SCOP Domain Sequences for d1ab6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ab6b_ c.23.1.1 (B:) CheY protein {Escherichia coli}
elkflvvddnstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmttaeakkeniiaaaqagasgyvvkpftaatleeklnkif
eklgm

Timeline for d1ab6b_:

• d1ab6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ab6b_ appears in SCOP 1.63
  
• d1ab6b_ appears in SCOP 1.67
  
• d1ab6b_ appears in the current release, SCOPe 2.08