Lineage for d5fiuc1 (5fiu C:8-192)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2170136Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2170137Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2170138Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 2170139Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 2170140Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries)
  8. 2170161Domain d5fiuc1: 5fiu C:8-192 [310547]
    Other proteins in same PDB: d5fiua2, d5fiub2, d5fiuc2
    automated match to d1rqpa2
    complexed with tla, y3j

Details for d5fiuc1

PDB Entry: 5fiu (more details), 1.84 Å

PDB Description: binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
PDB Compounds: (C:) 5'-fluoro-5'-deoxy-adenosine synthase

SCOPe Domain Sequences for d5fiuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fiuc1 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d5fiuc1:

Click to download the PDB-style file with coordinates for d5fiuc1.
(The format of our PDB-style files is described here.)

Timeline for d5fiuc1: