Lineage for d5ffma2 (5ffm A:325-621)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113143Protein YFV helicase domain [142330] (1 species)
  7. 2113144Species Yellow fever virus [TaxId:11089] [142331] (2 PDB entries)
    Uniprot P19901 1669-1842! Uniprot P19901 1843-2107
  8. 2113148Domain d5ffma2: 5ffm A:325-621 [310541]
    Other proteins in same PDB: d5ffma3

Details for d5ffma2

PDB Entry: 5ffm (more details), 2.6 Å

PDB Description: yellow fever virus helicase
PDB Compounds: (A:) Serine protease NS3

SCOPe Domain Sequences for d5ffma2:

Sequence, based on SEQRES records: (download)

>d5ffma2 c.37.1.14 (A:325-621) YFV helicase domain {Yellow fever virus [TaxId: 11089]}
gtsdefphsngeiedvqtdipsepwntghdwiladkrptawflpsiraanvmaaslrkag
ksvvvlnrktfereyptikqkkpdfilatdiaemganlcvervldcrtafkpvlvdegrk
vaikgplrisassaaqrrgrigrnpnrdgdsyyyseptsennahhvcwleasmlldnmev
rggmvaplygvegtktpvspgemrlrddqrkvfrelvrncdlpvwlswqvakaglktndr
kwcfegpeeheilndsgetvkcrapggakkplrprwcdervssdqsalsefikfaeg

Sequence, based on observed residues (ATOM records): (download)

>d5ffma2 c.37.1.14 (A:325-621) YFV helicase domain {Yellow fever virus [TaxId: 11089]}
gtsdefphsngeiedvqtdipsepwntghdwiladkrptawflpsiraanvmaaslrkag
ksvvvlnrkkpdfilatdiaemganlcvervldcrtafkpvlvdegrkvaikgplrisas
saaqrrgrigrnpnrdgdsyyyseptsennahhvcwleasmlldnmevrggmvaplygve
gtktpvspgemrlrddqrkvfrelvrncdlpvwlswqvakaglktndrkwcfegpeehei
lndsgetvkcrapggakkplrprwcdervssdqsalsefikfaeg

SCOPe Domain Coordinates for d5ffma2:

Click to download the PDB-style file with coordinates for d5ffma2.
(The format of our PDB-style files is described here.)

Timeline for d5ffma2:

  • d5ffma2 is new in SCOPe 2.06-stable