SCOPe 2.06: Domain d1ab6a_: 1ab6 A:

Lineage for d1ab6a_ (1ab6 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1ab6a_: 1ab6 A: [31054]
   mutant

Details for d1ab6a_

PDB Entry: 1ab6, 2.2 Å

PDB Description: structure of chey mutant f14n, v86t

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1ab6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ab6a_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
elkflvvddnstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmttaeakkeniiaaaqagasgyvvkpftaatleeklnkif
eklgm

Timeline for d1ab6a_:

• d1ab6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ab6a_ appears in SCOPe 2.05
  
• d1ab6a_ appears in SCOPe 2.07
  
• d1ab6a_ appears in the current release, SCOPe 2.08