Lineage for d5f9tb2 (5f9t B:274-740)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065539Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277389] (9 PDB entries)
  8. 2065545Domain d5f9tb2: 5f9t B:274-740 [310538]
    Other proteins in same PDB: d5f9ta1, d5f9ta3, d5f9tb1, d5f9tb3
    automated match to d2slia2
    complexed with fsi, gol, sfj

Details for d5f9tb2

PDB Entry: 5f9t (more details), 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, covalent complex with a fluorinated neu5ac derivative
PDB Compounds: (B:) Neuraminidase C

SCOPe Domain Sequences for d5f9tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f9tb2 b.68.1.0 (B:274-740) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

SCOPe Domain Coordinates for d5f9tb2:

Click to download the PDB-style file with coordinates for d5f9tb2.
(The format of our PDB-style files is described here.)

Timeline for d5f9tb2:

  • d5f9tb2 is new in SCOPe 2.06-stable