| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries) |
| Domain d5f9tb1: 5f9t B:83-273 [310537] Other proteins in same PDB: d5f9ta2, d5f9ta3, d5f9tb2, d5f9tb3 automated match to d2slia1 complexed with fsi, gol, sfj |
PDB Entry: 5f9t (more details), 2.05 Å
SCOPe Domain Sequences for d5f9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f9tb1 b.29.1.0 (B:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt
Timeline for d5f9tb1: