SCOPe 2.06: Domain d5f9ta2: 5f9t A:274-740

Lineage for d5f9ta2 (5f9t A:274-740)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (15 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277389] (9 PDB entries)

8. Domain d5f9ta2: 5f9t A:274-740 [310535]
   Other proteins in same PDB: d5f9ta1, d5f9ta3, d5f9tb1, d5f9tb3
   automated match to d2slia2
   complexed with fsi, gol, sfj

Details for d5f9ta2

PDB Entry: 5f9t, 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, covalent complex with a fluorinated neu5ac derivative

PDB Compounds: (A:) Neuraminidase C

SCOPe Domain Sequences for d5f9ta2:

Sequence; same for both SEQRES and ATOM records:

>d5f9ta2 b.68.1.0 (A:274-740) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

Timeline for d5f9ta2:

• d5f9ta2 is new in SCOPe 2.06-stable
  
• d5f9ta2 appears in SCOPe 2.07
  
• d5f9ta2 appears in the current release, SCOPe 2.08