Lineage for d5f9ta1 (5f9t A:83-273)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (54 species)
    not a true protein
  7. 2375575Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)
  8. 2375580Domain d5f9ta1: 5f9t A:83-273 [310534]
    Other proteins in same PDB: d5f9ta2, d5f9ta3, d5f9tb2, d5f9tb3
    automated match to d2slia1
    complexed with fsi, gol, sfj

Details for d5f9ta1

PDB Entry: 5f9t (more details), 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, covalent complex with a fluorinated neu5ac derivative
PDB Compounds: (A:) Neuraminidase C

SCOPe Domain Sequences for d5f9ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f9ta1 b.29.1.0 (A:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

SCOPe Domain Coordinates for d5f9ta1:

Click to download the PDB-style file with coordinates for d5f9ta1.
(The format of our PDB-style files is described here.)

Timeline for d5f9ta1: