SCOPe 2.08: Domain d5f9ta1: 5f9t A:83-273

Lineage for d5f9ta1 (5f9t A:83-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)

8. Domain d5f9ta1: 5f9t A:83-273 [310534]
   Other proteins in same PDB: d5f9ta2, d5f9ta3, d5f9tb2, d5f9tb3
   automated match to d2slia1
   complexed with fsi, gol, sfj

Details for d5f9ta1

PDB Entry: 5f9t, 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, covalent complex with a fluorinated neu5ac derivative

PDB Compounds: (A:) Neuraminidase C

SCOPe Domain Sequences for d5f9ta1:

Sequence; same for both SEQRES and ATOM records:

>d5f9ta1 b.29.1.0 (A:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

Timeline for d5f9ta1:

• d5f9ta1 first appeared in SCOPe 2.06
  
• d5f9ta1 appears in SCOPe 2.07