Lineage for d5f1qb_ (5f1q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145367Species Yersinia pestis [TaxId:377628] [311500] (1 PDB entry)
  8. 2145369Domain d5f1qb_: 5f1q B: [310531]
    Other proteins in same PDB: d5f1qa2
    automated match to d1dppa_
    complexed with cl, edo, gln, gol, peg

Details for d5f1qb_

PDB Entry: 5f1q (more details), 1.96 Å

PDB Description: crystal structure of periplasmic dipeptide transport protein from yersinia pestis
PDB Compounds: (B:) Periplasmic dipeptide transport protein

SCOPe Domain Sequences for d5f1qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1qb_ c.94.1.1 (B:) automated matches {Yersinia pestis [TaxId: 377628]}
ktlvycsegspegfnpqlftsgttydassvpiynrlvefkigtteiepslaerwevsedg
ktytfylrkgvkwqdnkdfkptrdfnaddviysfmrqkddknpyhkvsggsyeyfqgmgm
gdlitnvvkvddntvrfeltrpespfladlamdfasilsaeyadnmlkagtpekvdlnpi
gtgpfqlqqyqkdsrilykafpgfwgtkpkidrlvfsitpdasvryaklqknecqimpyp
npadiarmkedktinlmeqpglnvgylsfniekkpldnlkvrqaltmavnkdaiidavyq
gagqaaknlipptmwgynddvkdyaydpakakellkeaglpdgfsidlwampvqrpynpn
arrmaemiqsdwakigvkakivtyewgeylkrakdgehetvmmgwtgdngdpdnffatlf
scdaakqgsnyskwcykpfedliqparaeadhdkrvalykqaqvvmneqapaliiahstv
yepvrkevkgyvvdplgkhhfdnvsld

SCOPe Domain Coordinates for d5f1qb_:

Click to download the PDB-style file with coordinates for d5f1qb_.
(The format of our PDB-style files is described here.)

Timeline for d5f1qb_:

  • d5f1qb_ is new in SCOPe 2.06-stable