Lineage for d1ehc__ (1ehc -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (24 PDB entries) 
Domain d1ehc__: 1ehc - [31053]
Details for d1ehc__
PDB Entry: 1ehc (more details), 2.26 Å
PDB Description: structure of signal transduction protein chey
SCOP Domain Sequences for d1ehc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehc__ c.23.1.1 (-) CheY protein {Escherichia coli}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d1ehc__:
Click to download the PDB-style file with coordinates for d1ehc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehc__:
- d1ehc__ appears in SCOP 1.57
- d1ehc__ appears in the current release, SCOPe 2.08, called d1ehca_
View in 3D