Lineage for d5eumb_ (5eum B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114184Species Haemophilus influenzae [TaxId:374933] [311499] (1 PDB entry)
  8. 2114186Domain d5eumb_: 5eum B: [310528]
    automated match to d5dgxa_
    complexed with act, cl, mli, sin, so4

Details for d5eumb_

PDB Entry: 5eum (more details), 1.8 Å

PDB Description: 1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
PDB Compounds: (B:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d5eumb_:

Sequence, based on SEQRES records: (download)

>d5eumb_ c.37.1.0 (B:) automated matches {Haemophilus influenzae [TaxId: 374933]}
kddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkstian
lvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniayaaqdkysr
eeiiaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlildea
tsaldteseraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhktlle
qngaykqlhsmqftg

Sequence, based on observed residues (ATOM records): (download)

>d5eumb_ c.37.1.0 (B:) automated matches {Haemophilus influenzae [TaxId: 374933]}
kddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkstian
lvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniaydkysreei
iaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlildeatte
seraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhktlleqngaykq
lhsmqftg

SCOPe Domain Coordinates for d5eumb_:

Click to download the PDB-style file with coordinates for d5eumb_.
(The format of our PDB-style files is described here.)

Timeline for d5eumb_:

  • d5eumb_ is new in SCOPe 2.06-stable